powered by:
Protein Alignment CG17985 and Lysmd2
DIOPT Version :9
Sequence 1: | NP_610305.1 |
Gene: | CG17985 / 35702 |
FlyBaseID: | FBgn0033199 |
Length: | 271 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006243468.1 |
Gene: | Lysmd2 / 300839 |
RGDID: | 1304585 |
Length: | 282 |
Species: | Rattus norvegicus |
Alignment Length: | 60 |
Identity: | 22/60 - (36%) |
Similarity: | 31/60 - (51%) |
Gaps: | 10/60 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 ARPAYDDDEFEDLLPLAR---RPNG-----HARLGR--YENTLEVKVQEGDTLQALALRF 74
:|...:.:|.|..|.||| |..| .|.||. .|..:|.:|:.|||||.:||::
Rat 162 SRSTSEPEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRVRAGDTLQGIALKY 221
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166350977 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR20932 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.