DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and Lysmd2

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006243468.1 Gene:Lysmd2 / 300839 RGDID:1304585 Length:282 Species:Rattus norvegicus


Alignment Length:60 Identity:22/60 - (36%)
Similarity:31/60 - (51%) Gaps:10/60 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ARPAYDDDEFEDLLPLAR---RPNG-----HARLGR--YENTLEVKVQEGDTLQALALRF 74
            :|...:.:|.|..|.|||   |..|     .|.||.  .|..:|.:|:.|||||.:||::
  Rat   162 SRSTSEPEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRVRAGDTLQGIALKY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 8/16 (50%)
LysM <60..105 CDD:224306 8/15 (53%)
Lysmd2XP_006243468.1 LysM 204..>224 CDD:212030 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20932
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.