Sequence 1: | NP_610305.1 | Gene: | CG17985 / 35702 | FlyBaseID: | FBgn0033199 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_699205.1 | Gene: | LYSMD2 / 256586 | HGNCID: | 28571 | Length: | 215 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 59/202 - (29%) |
---|---|---|---|
Similarity: | 92/202 - (45%) | Gaps: | 35/202 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 ARPAYDDDEFEDLLPLAR---RPNG-----HARLGR--YENTLEVKVQEGDTLQALALRFHSSVA 79
Fly 80 DIKRLNKIDRENEIHAHRVIRIPVTVHNVLLGNGGLEALPAVHRSGNNSPRHNI--EREPA---- 138
Fly 139 --PERNPLE-DARQMLDERLLVAAVNASGAVDHEKPSTSRAAGQFYEGAQGAPNDEANMEQPYEE 200
Fly 201 NAALLNH 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17985 | NP_610305.1 | LysM | 59..102 | CDD:279777 | 14/42 (33%) |
LysM | <60..105 | CDD:224306 | 17/44 (39%) | ||
LYSMD2 | NP_699205.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..40 | 2/10 (20%) | |
mltD | <35..131 | CDD:182727 | 35/99 (35%) | ||
LysM | 71..115 | CDD:212030 | 15/43 (35%) | ||
Nup88 | <101..206 | CDD:401976 | 26/117 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 132..175 | 9/44 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..215 | 11/32 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165157021 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR20932 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |