DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and LYSMD2

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_699205.1 Gene:LYSMD2 / 256586 HGNCID:28571 Length:215 Species:Homo sapiens


Alignment Length:202 Identity:59/202 - (29%)
Similarity:92/202 - (45%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ARPAYDDDEFEDLLPLAR---RPNG-----HARLGR--YENTLEVKVQEGDTLQALALRFHSSVA 79
            :|...:.:|.|..|.|||   |..|     .|.||.  .|..:|.:|:.|||||.:||::..::.
Human    29 SRSGSESEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRVRAGDTLQGIALKYGVTME 93

  Fly    80 DIKRLNKIDRENEIHAHRVIRIPVTVHNVLLGNGGLEALPAVHRSGNNSPRHNI--EREPA---- 138
            .|||.||:...:.|...:.:.|||.....||.||    |.::....|.:..::.  |.||.    
Human    94 QIKRANKLFTNDCIFLKKTLNIPVISEKPLLFNG----LNSIDSPENETADNSFSQEEEPVVAGE 154

  Fly   139 --PERNPLE-DARQMLDERLLVAAVNASGAVDHEKPSTSRAAGQFYEGAQGAPNDEANMEQPYEE 200
              |..:|.| |.:.:..|.  |:|.:....:|.:...:::||.:..|.::    ||   |.||  
Human   155 DLPPPSPQESDVQPVQPEE--VSARDFLQRLDLQIKLSTQAAKKLKEESR----DE---ESPY-- 208

  Fly   201 NAALLNH 207
             |..|.|
Human   209 -ATSLYH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 14/42 (33%)
LysM <60..105 CDD:224306 17/44 (39%)
LYSMD2NP_699205.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 2/10 (20%)
mltD <35..131 CDD:182727 35/99 (35%)
LysM 71..115 CDD:212030 15/43 (35%)
Nup88 <101..206 CDD:401976 26/117 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..175 9/44 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..215 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20932
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.