DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and lmd-1

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001122475.1 Gene:lmd-1 / 185715 WormBaseID:WBGene00009665 Length:209 Species:Caenorhabditis elegans


Alignment Length:226 Identity:55/226 - (24%)
Similarity:82/226 - (36%) Gaps:68/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVTVHNVLLGNGGLEALPAV 121
            :|.||:.||||..||:::..:||:|||:|.:..|.:..|...::|||:...:.||     ...|:
 Worm    40 IERKVKNGDTLNKLAIKYQVNVAEIKRVNNMVSEQDFMALSKVKIPVSRMRMALG-----VQSAL 99

  Fly   122 HRSGNN------SPRHNIEREPAPERNP-LEDARQMLDERLLVAAVNASGAVDHEKPSTSRAAGQ 179
            .:...:      ..|..:.||....|:| :||.....|..:        ..|....|..|.....
 Worm   100 SQDEEDEILIDIDDRTALLREDRGSRDPSVEDIFHKTDTNI--------AQVREALPEESHGVTG 156

  Fly   180 FYEGAQGAPNDEANMEQPYEENAALLNHMVDRHAPLVRPIPGPSLSAIDWSGSDCDLSWICLLIF 244
            |                          |.|...||     ...|:|.           |:.:|..
 Worm   157 F--------------------------HFVTARAP-----TSSSISV-----------WMVVLGV 179

  Fly   245 ILALCVVIPLVYVIY----LAEHPHH-NHSA 270
            :|..| |:|||...|    .|.|.|. .|:|
 Worm   180 LLIFC-VLPLVLTFYEEQEEAAHQHKTTHAA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 16/42 (38%)
LysM <60..105 CDD:224306 19/44 (43%)
lmd-1NP_001122475.1 LysM 43..84 CDD:197609 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002722
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2979
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.