DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and LYSMD4

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_689662.2 Gene:LYSMD4 / 145748 HGNCID:26571 Length:297 Species:Homo sapiens


Alignment Length:238 Identity:57/238 - (23%)
Similarity:90/238 - (37%) Gaps:88/238 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RPNGHARLGRYENTLEVKVQEGDTLQALALRFHS-------SVADIKRLNKIDRENEIHAHRVIR 100
            ||||                .|||.|.|...|::       .|||||::|...||.:::|.:.::
Human    70 RPNG----------------AGDTRQNLIPDFYAFRVINNGKVADIKKVNNFIREQDLYALKSVK 118

  Fly   101 IPVTVHNVLLGNGGLEALPAVHRSGNNSPRHNIEREPAPERNPLEDARQMLDERLLVAAVNASGA 165
            |||..|.:|:                         |...|..||             .:.::...
Human   119 IPVRNHGILM-------------------------ETHKELKPL-------------LSPSSETT 145

  Fly   166 VDHEKPSTSRA-------AGQ---FYEG----AQGAPNDEANMEQPYEENAALLNHMVDRHAPLV 216
            |..|.|...||       |||   |::|    .:.|...|..:.:.|        .|...|.|| 
Human   146 VTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESY--------CMDTSHQPL- 201

  Fly   217 RPIPGPSLSAIDWSGSDCDLSWICLLIFILALCVVIPLVYVIY 259
              :|.|..:.:|  |:||.:.|...:..:|.:.:|:|:.|::|
Human   202 --LPAPPKTPMD--GADCGIQWWNAVFIMLLIGIVLPVFYLVY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 15/49 (31%)
LysM <60..105 CDD:224306 18/51 (35%)
LYSMD4NP_689662.2 CyoA 209..>295 CDD:224537 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5412
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1180847at2759
OrthoFinder 1 1.000 - - FOG0002722
OrthoInspector 1 1.000 - - otm41876
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2979
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.