DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and LYSMD3

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_938014.1 Gene:LYSMD3 / 116068 HGNCID:26969 Length:306 Species:Homo sapiens


Alignment Length:259 Identity:63/259 - (24%)
Similarity:104/259 - (40%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DEFEDLLPLARRPNGHARLGRYENTLEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAH 96
            |..:|::.|.:                 .:||||||.|:||::..:||||||:|.:..:.:..|.
Human    57 DRLDDIIVLTK-----------------DIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFAL 104

  Fly    97 RVIRIPVTVHNVLLGNGGLEAL-PAVHRSGNNSPRHNIEREPAPERNPLEDARQMLDERLLVAAV 160
            |.|:|||...:.|     .|.| |.   .|..:.||:              :.|...|:..:...
Human   105 RSIKIPVKKFSSL-----TETLCPP---KGRQTSRHS--------------SVQYSSEQQEILPA 147

  Fly   161 NASGAVDHEKPSTSRAAGQFYEGAQGAPNDEANMEQPYE------ENAALLNHMVD-------RH 212
            |.|.|.       |.:||.|.:..      :.::||..:      ||   ||.:|.       |.
Human   148 NDSLAY-------SDSAGSFLKEV------DRDIEQIVKCTDNKREN---LNEVVSALTAQQMRF 196

  Fly   213 AP----LVRPIPGPSLSAIDWSGSDCDLSWICLLIFILALCVVIPLVYVIY---LAEHPHHNHS 269
            .|    ..|..|        :.|:|..:.|...::.:|.:.::.|:.|::|   ||:....:||
Human   197 EPDNKNTQRKDP--------YYGADWGIGWWTAVVIMLIVGIITPVFYLLYYEILAKVDVSHHS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 19/42 (45%)
LysM <60..105 CDD:224306 22/44 (50%)
LYSMD3NP_938014.1 LysM 69..109 CDD:212030 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157018
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5412
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1180847at2759
OrthoFinder 1 1.000 - - FOG0002722
OrthoInspector 1 1.000 - - otm41876
orthoMCL 1 0.900 - - OOG6_108954
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2979
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.690

Return to query results.
Submit another query.