DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and lysmd1

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001096341.1 Gene:lysmd1 / 100124927 XenbaseID:XB-GENE-989799 Length:218 Species:Xenopus tropicalis


Alignment Length:198 Identity:52/198 - (26%)
Similarity:82/198 - (41%) Gaps:40/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LARRPNGHARLGRYENTLEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVT 104
            |.:.|...||:.:    ||.:||.|||||.||||:..::..|||.|::...:.|...:.:.|||.
 Frog    24 LVQSPYSPARIRK----LEHQVQPGDTLQGLALRYGVTMEQIKRANRLYTNDSIFLKKSLCIPVL 84

  Fly   105 VHNVLLGN-------GGLEALP---AVHRSGNNSPRHNIEREPAPERNPLEDARQMLDERLLV-- 157
            ...:.|.:       .|.|..|   ...|......||:..::  .|.:|| |....||..:.|  
 Frog    85 ADQLHLSDDQNSQDGSGAEGSPIQQQPERGEKQKSRHHAAQK--DEMSPL-DFMSRLDTNIRVSK 146

  Fly   158 -AAV----NASGAVDHEKPSTSRAAGQFYEGAQGAPNDEANMEQPYEENAALLNHMVDRHAPLVR 217
             |||    ........::|:...|.|  |:.....|:.:::   |..:..:||.           
 Frog   147 RAAVKKLREGESFTTEDEPTAGSAGG--YQSPNRTPSSQSS---PQTQQRSLLG----------- 195

  Fly   218 PIP 220
            |:|
 Frog   196 PVP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 16/42 (38%)
LysM <60..105 CDD:224306 19/44 (43%)
lysmd1NP_001096341.1 LysM 39..82 CDD:366664 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I5296
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.