Sequence 1: | NP_610305.1 | Gene: | CG17985 / 35702 | FlyBaseID: | FBgn0033199 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001096341.1 | Gene: | lysmd1 / 100124927 | XenbaseID: | XB-GENE-989799 | Length: | 218 | Species: | Xenopus tropicalis |
Alignment Length: | 198 | Identity: | 52/198 - (26%) |
---|---|---|---|
Similarity: | 82/198 - (41%) | Gaps: | 40/198 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 LARRPNGHARLGRYENTLEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVT 104
Fly 105 VHNVLLGN-------GGLEALP---AVHRSGNNSPRHNIEREPAPERNPLEDARQMLDERLLV-- 157
Fly 158 -AAV----NASGAVDHEKPSTSRAAGQFYEGAQGAPNDEANMEQPYEENAALLNHMVDRHAPLVR 217
Fly 218 PIP 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17985 | NP_610305.1 | LysM | 59..102 | CDD:279777 | 16/42 (38%) |
LysM | <60..105 | CDD:224306 | 19/44 (43%) | ||
lysmd1 | NP_001096341.1 | LysM | 39..82 | CDD:366664 | 16/42 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 46 | 1.000 | Inparanoid score | I5296 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR20932 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.150 |