DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and RPT6

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_011467.1 Gene:RPT6 / 852834 SGDID:S000003016 Length:405 Species:Saccharomyces cerevisiae


Alignment Length:392 Identity:181/392 - (46%)
Similarity:251/392 - (64%) Gaps:27/392 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LKTYGQSQYHKS---IKSIEEDIQKAVKQVNELTG----IKESDTGLAPPALWDLAADKQILQNE 90
            :|.|.:.:..::   |:|..|::::...|.|.|..    ||:               :.::|| |
Yeast    19 IKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKD---------------ELRLLQ-E 67

  Fly    91 QPLQVARCTKIINADSDDPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPP 155
            ....|....||::    |.|.::.|:...|::||:|..:...|::...||.:..:.|.:|..|..
Yeast    68 PGSYVGEVIKIVS----DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLEN 128

  Fly   156 KIDPTVTMMQVEDKPDVTYSDVGGCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGT 220
            |.||.|::|.||..||.||..|||..:||::::||:|.|:.|||.|.:|||..||||:|:|||||
Yeast   129 KADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGT 193

  Fly   221 GKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARF 285
            ||||.|||||:.||..||||.|:||||||:|||:|||||||.|||.....:||.||||:||..|.
Yeast   194 GKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRV 258

  Fly   286 DDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDG 350
            :...|||:|||||||||:||||||:...|||::|||||.|.|||||:||||:|||:||..|....
Yeast   259 EGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAA 323

  Fly   351 RSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKK 415
            |:.|.:||:|.|::.|.|....:|......:||:::.|||||||:|:|.||...|::||..||.|
Yeast   324 RAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGK 388

  Fly   416 VI 417
            |:
Yeast   389 VM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 181/392 (46%)
RPT6NP_011467.1 RPT1 12..403 CDD:224143 181/392 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.