DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and KATNAL2

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001340828.1 Gene:KATNAL2 / 83473 HGNCID:25387 Length:564 Species:Homo sapiens


Alignment Length:271 Identity:81/271 - (29%)
Similarity:144/271 - (53%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PDVTYSDVGGCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTD 234
            |::.::|:.|.....:.::|.|..|:.:|:.|..: :.|.||:||:|||||||||.|:|||....
Human   275 PNIKWNDIIGLDAAKQLVKEAVVYPIRYPQLFTGI-LSPWKGLLLYGPPGTGKTLLAKAVATECK 338

  Fly   235 ACFIRVIGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQ-RT 298
            ..|..:..|.:|.|:.|:..::||.|||:||......||.||::::...| ...:||::|.. |.
Human   339 TTFFNISASTIVSKWRGDSEKLVRVLFELARYHAPSTIFLDELESVMSQR-GTASGGEHEGSLRM 402

  Fly   299 MLELINQLDGFDPRGN-IKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIH---- 358
            ..||:.|:||.....: :.||.|:|.|..||.|::|  ||::::...||.::.|..:. .|    
Human   403 KTELLVQMDGLARSEDLVFVLAASNLPWELDCAMLR--RLEKRILVDLPSREARQAMI-YHWLPP 464

  Fly   359 ---ARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAI------------------RARRK 402
               :|::.:..::.:.:|::.....:|::|:.||.||.|..:                  |.:..
Human   465 VSKSRALELHTELEYSVLSQETEGYSGSDIKLVCREAAMRPVRKIFDALENHQSESSDLPRIQLD 529

  Fly   403 VATEKDFLEAV 413
            :.|..|||:.:
Human   530 IVTTADFLDVL 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 81/271 (30%)
KATNAL2NP_001340828.1 LisH 51..81 CDD:128913
SpoVK <264..559 CDD:223540 81/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.