DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and gk5

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001071271.3 Gene:gk5 / 777765 ZFINID:ZDB-GENE-061110-49 Length:529 Species:Danio rerio


Alignment Length:178 Identity:32/178 - (17%)
Similarity:53/178 - (29%) Gaps:64/178 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 VGVDRNKYQIHIPLPPKIDPTVTMMQ--VEDKPDVTYSDVGGCKEQIEKLREVVETPLLHPEK-- 200
            :|..||.|.........:|...|.::  |.||   :.|..|.|..::.         ||:|:.  
Zfish     1 MGTQRNGYSKRETFILSVDVGTTSIRCHVYDK---SASIRGSCSAKVS---------LLYPQPGW 53

  Fly   201 -----------FV------------------NLGIEPPKGVLLFGPPGTGKTL----------CA 226
                       ||                  :|||...:...:.....|||..          .|
Zfish    54 VEIDPDELWDGFVTVVKGAVQDSGLQMCQMESLGISTQRATFMTWDRNTGKPFHKFITWQDMRAA 118

  Fly   227 RAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARSKKACLIFF 274
            ..|.:...:|.::.:...:         :|:..|....|...|.|:.|
Zfish   119 ELVRSWNGSCTMKTVHGVM---------KMLHFLSRQKRFLAASLVVF 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 32/178 (18%)
gk5NP_001071271.3 GlpK 14..525 CDD:223628 28/165 (17%)
FGGY_GK5_metazoa 14..522 CDD:212665 28/165 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.