DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and Fggy

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_011238935.1 Gene:Fggy / 75578 MGIID:1922828 Length:560 Species:Mus musculus


Alignment Length:216 Identity:41/216 - (18%)
Similarity:65/216 - (30%) Gaps:78/216 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DKEIKSL---DEGD-----IELLKTYGQSQYHKSIKSIEEDIQKAVKQVNELTGIKESDTGLAPP 75
            |||...|   .|||     |..|.....||.|:    |.|...:.::.|..:..::..    ||.
Mouse   102 DKEFHPLPVNHEGDSSRNVIMWLDHRAVSQVHR----INETKHRVLQYVGGVMSVEMQ----APK 158

  Fly    76 ALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYI------INVKQFAKFVVDLADSVAPTDI 134
            .||       :.:|.:.:    |........|.|.::      :..:.....|.....|.     
Mouse   159 LLW-------LKENLREI----CWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSA----- 207

  Fly   135 EEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKEQIEKLREVVETPLLHPE 199
            |:|..                  |....|:.:||..|..||.:|..              :|.|.
Mouse   208 EKGWD------------------DSFWKMIGLEDLIDDNYSKIGNL--------------VLLPG 240

  Fly   200 KFVNLGIEP--------PKGV 212
            ..:.:|:.|        |.|:
Mouse   241 AALGIGLTPEAARELGLPSGI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 37/205 (18%)
FggyXP_011238935.1 FGGY_YpCarbK_like 19..553 CDD:212663 41/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.