DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and PSMC6

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_002797.4 Gene:PSMC6 / 5706 HGNCID:9553 Length:389 Species:Homo sapiens


Alignment Length:415 Identity:176/415 - (42%)
Similarity:252/415 - (60%) Gaps:46/415 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGDDQRKVKHDEKEDKEIKSLDEGDIELLKTYGQSQYHKSIKSIEEDIQKAVKQVNELTGIKESD 69
            |.|.::|:...::.|..:|.|.|...||.|     ||.||    |.|: ||::.|.::.|     
Human     9 LQDYRKKLLEHKEIDGRLKELREQLKELTK-----QYEKS----ENDL-KALQSVGQIVG----- 58

  Fly    70 TGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQFAKFVVDLADSVAPTDI 134
                       ...||:.:.          |.|...::.|:|::..::          .:..:.:
Human    59 -----------EVLKQLTEE----------KFIVKATNGPRYVVGCRR----------QLDKSKL 92

  Fly   135 EEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKEQIEKLREVVETPLLHPE 199
            :.|.||.:|.....|...||.::||.|..|..||..:|:||::||..|||.:||||:|.||.:||
Human    93 KPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPE 157

  Fly   200 KFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMA 264
            .|..:||.||||.||:|||||||||.|||||::.|..|::|:.|.:|.||:||.||::||:|..|
Human   158 LFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYA 222

  Fly   265 RSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDP 329
            |..:.|:||.||||||||.||.:|...|.|:|||::||:||:||||....:|::|||||||||||
Human   223 RDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDP 287

  Fly   330 ALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGM 394
            ||:||||||||:...||::..|..|.||||..::...:|.::.:.:|.....||::|:|||||||
Human   288 ALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGM 352

  Fly   395 FAIRARRKVATEKDFLEAVKKVIKS 419
            |||||......::||::||:||..|
Human   353 FAIRADHDFVVQEDFMKAVRKVADS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 170/393 (43%)
PSMC6NP_002797.4 RPT1 4..387 CDD:224143 176/415 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.