DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and PSMC3

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_016873515.1 Gene:PSMC3 / 5702 HGNCID:9549 Length:461 Species:Homo sapiens


Alignment Length:412 Identity:164/412 - (39%)
Similarity:237/412 - (57%) Gaps:57/412 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYLGDDQRKVKHDE------KEDKEIKSLDEGDIELLKTYGQSQYHKSIKSIEEDIQK------- 54
            |.:|::..|:..:|      ..|.|||.:..   |:|:...:.|..|.  .|:|:.:|       
Human    27 DGIGEEVLKMSTEEIIQRTRLLDSEIKIMKS---EVLRVTHELQAMKD--KIKENSEKIKVNKTL 86

  Fly    55 --AVKQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQV-------ARCTKIINADSDDPK 110
              .|..|.||..:..:|                  |.|....:       .:|..|  ..|....
Human    87 PYLVSNVIELLDVDPND------------------QEEDGANIDLDSQRKGKCAVI--KTSTRQT 131

  Fly   111 YIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYS 175
            |.:.|..    :|| |:.:.|.|:     |||:::.|.|...||.:.|..|..|:|:::|...||
Human   132 YFLPVIG----LVD-AEKLKPGDL-----VGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYS 186

  Fly   176 DVGGCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV 240
            |:||..:||::|.|.:..|:.|.|||.||||:||||||::|||||||||.|||.|.:|.|.|:::
Human   187 DIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKL 251

  Fly   241 IGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQ 305
            .|.:|||.::|:||::||:.|.:|:.|...:||.||:||||..|||....||.|||||||||:||
Human   252 AGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQ 316

  Fly   306 LDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRF 370
            ||||.|...:||:.||||.|.|||||:|.||||||:||.:|:::.|:.|.:||:|.|:|..|:.:
Human   317 LDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNY 381

  Fly   371 DLLARLCPNSTGAEIRSVCTEA 392
            :.|||...:..||:.::||.||
Human   382 EELARCTDDFNGAQCKAVCVEA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 156/382 (41%)
PSMC3XP_016873515.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.