DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and PSMC1

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_002793.2 Gene:PSMC1 / 5700 HGNCID:9547 Length:440 Species:Homo sapiens


Alignment Length:446 Identity:178/446 - (39%)
Similarity:261/446 - (58%) Gaps:58/446 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDYLGDDQRKVKHDEKEDK----------EIKSLDEGDIELLKTY---------GQSQYHKSIK 46
            :|..:|..::|.|..:...|          .:|.|   .:|.:|.|         .|.|    :|
Human    29 VPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLL---KLERIKDYLLMEEEFIRNQEQ----MK 86

  Fly    47 SIEEDIQKAVKQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKY 111
            .:||..::...:|::|.|                          .|:.|....:||    ||...
Human    87 PLEEKQEEERSKVDDLRG--------------------------TPMSVGTLEEII----DDNHA 121

  Fly   112 IINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSD 176
            |::....::..|.:...|....:|.|..|.::...:.:...|....||.||:|:||..|..||:|
Human   122 IVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYAD 186

  Fly   177 VGGCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVI 241
            :||...||::::|.||.||.|||.:..:||:|||||:|:|||||||||.|:||||:|.|.|:||:
Human   187 IGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVV 251

  Fly   242 GSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQL 306
            ||||:|||:|:|.::|||||.:|......::|.|||||||..|:|..:||:.|:|||||||:|||
Human   252 GSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQL 316

  Fly   307 DGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFD 371
            ||||.||::||:|||||.:||||||:||||:|||:||.|||:..:..||:||...|::..|:..|
Human   317 DGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLD 381

  Fly   372 LLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKVIKSYAKFSATP 427
            .|.....:.:||:|:::|||||:.|:|.||...|.:||.::.:.|:  |.|...||
Human   382 DLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVL--YKKQEGTP 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 171/410 (42%)
PSMC1NP_002793.2 PTZ00361 1..440 CDD:185575 178/446 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.