DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and Kat60

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster


Alignment Length:280 Identity:102/280 - (36%)
Similarity:148/280 - (52%) Gaps:30/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 VEDKPDVTYSDVGGCKEQIEKLREVVETPLLHPEKFVNLGIEPP-KGVLLFGPPGTGKTLCARAV 229
            ::..|.|.:||:....:....|.|.|..|:|.|:.|  .||..| ||||:.||||||||:.|:||
  Fly   317 LQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYF--KGIRRPWKGVLMVGPPGTGKTMLAKAV 379

  Fly   230 ANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNE 294
            |......|..|..:.|..||.||..:|||.||||||......||.||||::...|   |:..::|
  Fly   380 ATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTIFIDEIDSLCSRR---GSESEHE 441

  Fly   295 V-QRTMLELINQLDGF----DPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHI 354
            . :|...||:.|:||.    :....:.||.|||.|..:|.||.|  ||::::...||..:||..:
  Fly   442 ASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEALRR--RLEKRIYIPLPSDEGREAL 504

  Fly   355 FKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIRAR---------RKVATE---- 406
            .||:.|.:.|:..:....:|......:||:|.:||.||.|.::|.:         |::|||    
  Fly   505 LKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMSMRRKIAGLTPEQIRQLATEEVDL 569

  Fly   407 ----KDFLEAVKKVIKSYAK 422
                |||.||:.:..||.::
  Fly   570 PVSNKDFNEAMSRCNKSVSR 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 102/280 (36%)
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 27/57 (47%)
AAA 358..496 CDD:214640 60/142 (42%)
AAA 362..495 CDD:278434 57/137 (42%)
Vps4_C <570..603 CDD:286426 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.