DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and psmc3

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001006786.1 Gene:psmc3 / 448481 XenbaseID:XB-GENE-1009848 Length:423 Species:Xenopus tropicalis


Alignment Length:447 Identity:177/447 - (39%)
Similarity:254/447 - (56%) Gaps:56/447 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYLGDDQRKVKHDE------KEDKEIKSLDEGDIELLK-TYGQSQYHKSIKSIEEDIQ------K 54
            |.||::..|:..:|      ..|.|||.:..   |:|: |:........||...|.|:      .
 Frog    11 DGLGEEVLKMSTEEIIQRTRLLDSEIKIMKS---EVLRVTHELQAMRDKIKENSEKIKVNKTLPY 72

  Fly    55 AVKQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQV-------ARCTKIINADSDDPKYI 112
            .|..|.||..:..:|                  |.|....:       .:|..|  ..|....|.
 Frog    73 LVSNVIELLDVDPND------------------QEEDGANIDLDSQRKGKCAVI--KTSTRQTYF 117

  Fly   113 INVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDV 177
            :.|..    :|| |:.:.|.|:     |||:::.|.|...||.:.|..|..|:|:::|...|||:
 Frog   118 LPVIG----LVD-AEKLKPGDL-----VGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDI 172

  Fly   178 GGCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIG 242
            ||..:||::|.|.:..|:.|.|||.||||:||||||::|||||||||.|||.|.:|.|.|:::.|
 Frog   173 GGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAG 237

  Fly   243 SELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLD 307
            .:|||.::|:||::||:.|.:|:.|...:||.||:||||..|||....||.|||||||||:||||
 Frog   238 PQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLD 302

  Fly   308 GFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDL 372
            ||.|...:||:.||||.|.|||||:|.||||||:||.:|:::.|:.|.:||:|.|:|..|:.::.
 Frog   303 GFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEE 367

  Fly   373 LARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKVIKSYAKFSATPRY 429
            |||...:..||:.::||.||||.|:|......|.:|::|.:.:|   .||..|..:|
 Frog   368 LARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEV---QAKKKANLQY 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 168/417 (40%)
psmc3NP_001006786.1 RPT1 28..416 CDD:224143 170/423 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.