DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and Gk1

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster


Alignment Length:194 Identity:40/194 - (20%)
Similarity:68/194 - (35%) Gaps:57/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 AIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLD----PA---LMRP-- 334
            :|.||.|:......|.:|.:              |.|:. ||:...::||    ||   |..|  
  Fly   333 SIAGAAFNWLRDNMNLIQNS--------------GQIET-MASTVDNSLDVYFVPAFNGLYAPYW 382

  Fly   335 GRLDRKVEFGLPDQDGRSHI---------FKIHARSMSVERDIRF--------------DLLARL 376
            .:..|.|..||.::....||         |::.....|:.:|.:.              :|..:|
  Fly   383 NQDARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSMHKDCKIPLAKLMVDGGMTVNNLFLQL 447

  Fly   377 CPNSTGAEI--RSVCTEAGMFAIRARRKVATEKDFLEA------VKKVIKSYAKFSATPRYMTY 432
            ..:..|.::  ..:.....:.|..|..|....:..:||      .::.||  ...|||.|.:.|
  Fly   448 QSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPREAIK--PSISATDRNLRY 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 39/190 (21%)
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 40/194 (21%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 40/194 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.