DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and kat-60L1

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001163523.1 Gene:kat-60L1 / 40715 FlyBaseID:FBgn0037375 Length:673 Species:Drosophila melanogaster


Alignment Length:296 Identity:98/296 - (33%)
Similarity:150/296 - (50%) Gaps:36/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 YQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKEQIEKLREVVETPLLHPEKFVNLGIEPP-K 210
            |::|:     :| |:....::..|.:.::||.|..|....|:|.|..|::.||.|  .||..| :
  Fly   372 YEVHL-----VD-TLEKDILQRHPCIKWTDVAGLNEAKTILQEAVVLPVIMPEFF--KGIRRPWR 428

  Fly   211 GVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARSKKACLIFFD 275
            |||:.||||||||:.|:|||......|..|..|.|..||.||..::||.||||||......||.|
  Fly   429 GVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPSTIFID 493

  Fly   276 EIDAIGGARFDDGAGGDNEVQRTM-LELINQLDGFDPRGN----IKVLMATNRPDTLDPALMRPG 335
            ||||:..:|   |:..::|..|.. .||:.|:||.:....    |.||.|||.|..:|.|..|  
  Fly   494 EIDALCASR---GSDSEHEASRRFKAELLIQMDGLNASMQEEKVIMVLAATNHPWDIDEAFRR-- 553

  Fly   336 RLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIR-- 398
            |.::::...||::..||.:.|:..:.:.:...:...::.......:|::|.:||.:|.|.|:|  
  Fly   554 RFEKRIYIPLPNEGTRSALLKLCLKDVCLSPSLNTGIIGDELQGYSGSDISNVCRDASMMAMRRL 618

  Fly   399 ------------ARRKV---ATEKDFLEAVKKVIKS 419
                        .|.:|   .|.:||.:|..:..||
  Fly   619 ISGRTPDQIKQIRREEVDQPITLQDFQDARLRTKKS 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 98/296 (33%)
kat-60L1NP_001163523.1 AAA 426..565 CDD:214640 60/143 (42%)
AAA 430..563 CDD:278434 57/137 (42%)
Vps4_C <638..671 CDD:286426 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.