DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and psmc5

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_989358.1 Gene:psmc5 / 394988 XenbaseID:XB-GENE-999928 Length:414 Species:Xenopus tropicalis


Alignment Length:418 Identity:199/418 - (47%)
Similarity:264/418 - (63%) Gaps:35/418 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVKHDEKEDKEIKSLDE--GDIELLKTYGQSQYHKS--------IKSIEEDIQKAVKQVNELTGI 65
            ||..|..|..|   :||  |.|      |..||:.|        :....:::::...|.|||.  
 Frog     8 KVAGDGMEQME---MDESRGGI------GLRQYYLSKIEDLQLVVNDKSQNLRRLQAQRNELN-- 61

  Fly    66 KESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQFAKFVVDLADSVA 130
                   |...|  |..:.|:|| ||...|....:.:    |..|.::.|....|||||:..::.
 Frog    62 -------AKVRL--LREELQLLQ-EQGSYVGEVVRAM----DKKKVLVKVHPEGKFVVDIDKNID 112

  Fly   131 PTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKEQIEKLREVVETPL 195
            ..|:....||.:..:.|.:|..||.|:||.|::|.||..||.||..:||..:||::::||:|.|:
 Frog   113 INDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPV 177

  Fly   196 LHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVREL 260
            .|||.|..|||..||||||:|||||||||.|||||:.||..||||.|||||||::||||||||||
 Frog   178 KHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVREL 242

  Fly   261 FEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPD 325
            |.|||.....:||.||||:||.:|.:.|:|||:|||||||||:||||||:...||||:|||||.|
 Frog   243 FVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRID 307

  Fly   326 TLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCT 390
            .||.||:||||:|||:||..|:::.|..|.|||:|.|::.|.|....:|.|.|.::|||::.|||
 Frog   308 ILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCT 372

  Fly   391 EAGMFAIRARRKVATEKDFLEAVKKVIK 418
            ||||:|:|.||...|::||..||.||::
 Frog   373 EAGMYALRERRVHVTQEDFEMAVAKVMQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 193/402 (48%)
psmc5NP_989358.1 RPT1 15..412 CDD:224143 196/411 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.