DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and CG1271

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster


Alignment Length:346 Identity:74/346 - (21%)
Similarity:112/346 - (32%) Gaps:123/346 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 IINVKQF------AKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKP 170
            |:|.|:.      .|..|:|.||.    |...:|.|..|:|                  .||...
  Fly   188 IMNNKKLKQALMQKKARVELLDSW----ILHKLRTGSSRDK------------------DVEHIT 230

  Fly   171 DVTYSDVGGCKEQIEKLREVVETPLLHPEKFVNLGIEPP------KGV-----LLFGPPGTGKTL 224
            |||.|...|..:..    .:..:||:.....:|..|.|.      ||.     ..|||......:
  Fly   231 DVTSSTATGLYDPF----TLSWSPLISWLFGINSKILPRVVDNGYKGFGHVHPTAFGPDWANTEI 291

  Fly   225 -CARAVANRTDACFIRVIGSELVQK-----YVGEGA-----------RMVRELFEM--------A 264
             .|.:::::|.|    :.||:..||     .:|.||           .::..::.:        .
  Fly   292 PIAASLSDQTAA----IWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVAWQFKKPT 352

  Fly   265 RSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLD- 328
            |.:.|       :..|.||..|.|         |::......:.||...|...: |.:.|||.| 
  Fly   353 RQQGA-------VYCIEGASHDFG---------TVVTWAQSCELFDSPANTSDI-AQSVPDTNDV 400

  Fly   329 ---PALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCT 390
               ||..         ..|.|..|.||....|                 .|.|::|.|.:.....
  Fly   401 FFMPAFS---------GLGPPVNDYRSASGFI-----------------GLTPSTTKAHMVRALL 439

  Fly   391 EAGMF----AIRARRKVATEK 407
            |:.:|    .|.|..|..::|
  Fly   440 ESIVFRLVQLIEAAEKETSQK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 74/346 (21%)
CG1271NP_647763.1 GlpK 32..555 CDD:223628 74/346 (21%)
FGGY_GK5_metazoa 32..552 CDD:212665 74/346 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.