DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and Gk5

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_008764796.1 Gene:Gk5 / 367146 RGDID:1311223 Length:534 Species:Rattus norvegicus


Alignment Length:311 Identity:64/311 - (20%)
Similarity:107/311 - (34%) Gaps:90/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DIQKAVKQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSD---DPKYI 112
            :::|||::.|...|  ..||.|    |:.|....           :..|...||.:.   || |.
  Rat   186 EVKKAVEEDNCCFG--TIDTWL----LYKLTKGS-----------SYATDYSNASTTGFFDP-YA 232

  Fly   113 INVKQFAKFVVDLADSVAPTDIEEGMRVG-VDRNKYQIHIPLPPKIDPTVTMMQVE---DKPDV- 172
            :...:....:|.:..|:.|...:.....| ||...:.:.||:...:....:.|..|   :..|| 
  Rat   233 MRWSKLIATMVSIPFSILPPVRDTSYNFGSVDEEIFGVPIPVVALVGDQQSAMFGECCFETGDVK 297

  Fly   173 ------TYSDV----------GG--------------C---------------KEQIEKLREVVE 192
                  |:.|:          ||              |               .::::...:..|
  Rat   298 LTMGTGTFLDINTGKTPQHVNGGFYPLIGWKIGHELVCLAEGNAGDTGTAIVWAQKLDLFTDAAE 362

  Fly   193 TPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMV 257
            |     ||.. |.:|..:|| .|.|..:|    .:|..|...||     .|.:..|:......:|
  Rat   363 T-----EKMA-LSLEDSEGV-YFVPSFSG----LQAPLNDPCAC-----ASFMGLKHSTSKYHLV 411

  Fly   258 RELFEMA--RSKKACLIFFDEID-AIGGARFDDGAGGDNEVQRTMLELINQ 305
            |.:.|..  |:|:...:...||. .:...|.|.|...:..|.:...:|||:
  Rat   412 RAILESIAFRNKQLYDMLQREIQIPVTNIRADGGVCNNAFVMQMTSDLINE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 64/311 (21%)
Gk5XP_008764796.1 GlpK 23..530 CDD:223628 64/311 (21%)
FGGY_GK5_metazoa 25..527 CDD:212665 64/311 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.