DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and psmc4

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_956044.2 Gene:psmc4 / 326884 ZFINID:ZDB-GENE-030131-5083 Length:418 Species:Danio rerio


Alignment Length:433 Identity:161/433 - (37%)
Similarity:232/433 - (53%) Gaps:100/433 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYLGDDQRKVK----HDEKEDKEIKSL-----------DEGDIELLKTYGQSQYHKSIKSIEEDI 52
            :|:.|:|:.:|    |.::|.|.|:|:           |:....:..|.|.:.|.:.:.:|:.::
Zfish    59 EYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDREL 123

  Fly    53 QKAVKQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQ 117
            .|                                                      |...:.:.:
Zfish   124 LK------------------------------------------------------PNASVALHK 134

  Fly   118 FAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKE 182
            .:..:||:                           |||:.|.::.|:..:.||||.|||:||...
Zfish   135 HSNALVDV---------------------------LPPEADSSIMMLTSDQKPDVLYSDIGGMDI 172

  Fly   183 QIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQ 247
            |.:::||.||.||.|.|.:..:||:||:|||::||||.|||:.|:|||:.|.|.||||:|||.||
Zfish   173 QKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQ 237

  Fly   248 KYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPR 312
            ||:|||.||||::|.:|:.....:||.||||||...|||...|.|.||||.:|||:||:||||..
Zfish   238 KYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQN 302

  Fly   313 GNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRF-DLLARL 376
            .|:||:|||||.|||||||:||||||||:||.|||:..:..:|......|::..::.. |.:|| 
Zfish   303 VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEEVDLEDYVAR- 366

  Fly   377 CPNS-TGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKVIK 418
             |:. :||:|.|:|.||||.|:|..|.:...|||.:|.|.|||
Zfish   367 -PDKISGADINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 151/394 (38%)
psmc4NP_956044.2 PTZ00454 34..418 CDD:240423 161/433 (37%)
AAA 202..335 CDD:278434 86/132 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.