DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and GK2

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_149991.2 Gene:GK2 / 2712 HGNCID:4291 Length:553 Species:Homo sapiens


Alignment Length:490 Identity:97/490 - (19%)
Similarity:155/490 - (31%) Gaps:163/490 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EKEDKEI------------KSLDEGDIEL--LKTYGQSQYHKSI----KSIEEDIQKAV------ 56
            |::.|||            :.|||.:|::  :|..|.|...::.    |...|.:..||      
Human    54 EQDPKEILQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLR 118

  Fly    57 ---------KQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVA---------------- 96
                     |::...:...:|.|||.....:.....:.:|.|.:.:|.|                
Human   119 TQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDSWLI 183

  Fly    97 -----------RCTKIINADSDDPKYIINVK---------QFAKFVVDLADSVAPTD-----IEE 136
                       .||.:.||..   ..:.|:.         .|.:..:||..:|..:.     |:.
Human   184 WSLTGGVNGGVHCTDVTNASR---TMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIYGLIKT 245

  Fly   137 GMRVGVDRNKYQIHIPLPPKIDPTVT-----MMQVEDKPDVTYSDVGGCKEQIEKLREVV--ETP 194
            |...||         |:...:.....     |...|.:...||..  ||.......|:.|  |..
Human   246 GALEGV---------PISGCLGDQCAALVGQMCFQEGQAKNTYGT--GCFLLCNTGRKCVFSEHG 299

  Fly   195 LLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAV-----------------------ANRTDAC 236
            ||....: .||.|.|....|     .|....|.||                       ...:..|
Human   300 LLTTVAY-KLGREKPAYYAL-----EGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGC 358

  Fly   237 FIRVIGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLE 301
            :.....|.|...|....||.:  |..:.:....|.|.|..::|:   .|.         .|.:||
Human   359 YFVPAFSGLYAPYWEPSARGI--LCGLTQFTNKCHIAFAALEAV---CFQ---------TREILE 409

  Fly   302 LIN----------QLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSH--- 353
            .:|          |:||  ...|.||||.. :.|.|...:::| .:......|.....|.:.   
Human   410 AMNRDCGIPLRHLQVDG--GMTNNKVLMQL-QADILHIPVIKP-FMPETTALGAAMAAGAAEGVS 470

  Fly   354 IFKIHARSMSVERDIRFDLLARLCP--NSTGAEIR 386
            ::.:..:::||.|..||:      |  .:|.:|||
Human   471 VWSLEPQALSVLRMERFE------PQIQATESEIR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 91/467 (19%)
GK2NP_149991.2 FGGY_GK1-3_metazoa 11..513 CDD:212664 97/490 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.