DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and Psmc4

DIOPT Version :9

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_036004.2 Gene:Psmc4 / 23996 MGIID:1346093 Length:418 Species:Mus musculus


Alignment Length:433 Identity:160/433 - (36%)
Similarity:232/433 - (53%) Gaps:100/433 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYLGDDQRKVK----HDEKEDKEIKSL-----------DEGDIELLKTYGQSQYHKSIKSIEEDI 52
            :|:.|:|:.:|    |.::|.|.|:|:           |:....:..|.|.:.|.:.:.:|:.::
Mouse    59 EYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDREL 123

  Fly    53 QKAVKQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQ 117
            .|                                                      |...:.:.:
Mouse   124 LK------------------------------------------------------PNASVALHK 134

  Fly   118 FAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKE 182
            .:..:||:                           |||:.|.::.|:..:.||||.|:|:||...
Mouse   135 HSNALVDV---------------------------LPPEADSSIMMLTSDQKPDVMYADIGGMDI 172

  Fly   183 QIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQ 247
            |.:::||.||.||.|.|.:..:||:||:|||::||||.|||:.|:|||:.|.|.||||:|||.||
Mouse   173 QKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQ 237

  Fly   248 KYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPR 312
            ||:|||.||||::|.:|:.....:||.||||||...|||...|.|.||||.:|||:||:||||..
Mouse   238 KYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQN 302

  Fly   313 GNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRF-DLLARL 376
            .|:||:|||||.|||||||:||||||||:||.|||:..:..||......|::..::.. |.:|| 
Mouse   303 VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVAR- 366

  Fly   377 CPNS-TGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKVIK 418
             |:. :||:|.|:|.|:||.|:|..|.:...|||.:|.|.|||
Mouse   367 -PDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 150/394 (38%)
Psmc4NP_036004.2 PTZ00454 34..418 CDD:240423 160/433 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.