DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43340 and IBSP

DIOPT Version :9

Sequence 1:NP_001246184.1 Gene:CG43340 / 35698 FlyBaseID:FBgn0263077 Length:3213 Species:Drosophila melanogaster
Sequence 2:NP_004958.2 Gene:IBSP / 3381 HGNCID:5341 Length:317 Species:Homo sapiens


Alignment Length:188 Identity:47/188 - (25%)
Similarity:65/188 - (34%) Gaps:46/188 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1377 IEVVPLGSAELLSPSEPTEVVSPSAIALPEKPEPMENATEIEIEEMVSPTSVEIVPTTTEDLHQA 1441
            :....||..|..:|.  |.....:||.||:|...:.|....|.|               .|..:.
Human   107 LSATTLGYGEDATPG--TGYTGLAAIQLPKKAGDITNKATKEKE---------------SDEEEE 154

  Fly  1442 ESVVETARPVSAVEEVKPIEDSTAAIDKSPQISPIEGEHSQHSEKET----------PESVEVGL 1496
            |.           ||....|:|.|.:|::.|  .|.|..:..:|.|.          .|..|..:
Human   155 EE-----------EEGNENEESEAEVDENEQ--GINGTSTNSTEAENGNGSSGGDNGEEGEEESV 206

  Fly  1497 DSPNVADVITTSVEVIPTSTTAVTTSDGASTEMPEPPKIYCETAPPAAEEIEQNETVE 1554
            ...|..|...|..:...||.|  |||.....|...||::|..|:||    ..:..|||
Human   207 TGANAEDTTETGRQGKGTSKT--TTSPNGGFEPTTPPQVYRTTSPP----FGKTTTVE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43340NP_001246184.1 FYVE_BSN_PCLO 63..119 CDD:277290
IBSPNP_004958.2 BSP_II 17..314 CDD:283165 47/188 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..254 44/182 (24%)
cell-attachment tripeptide 286..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.