DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43340 and Muc18B

DIOPT Version :9

Sequence 1:NP_001246184.1 Gene:CG43340 / 35698 FlyBaseID:FBgn0263077 Length:3213 Species:Drosophila melanogaster
Sequence 2:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster


Alignment Length:310 Identity:67/310 - (21%)
Similarity:98/310 - (31%) Gaps:91/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1269 IDSLAAVESIDVKNQINSSNHMEQQNISIEPQPTVPMDTIQPIEIVQEVPCNTVDLIATTEAVNA 1333
            :.|:||.|:.|..|..|               ||:|...:.  |...|.|  ..:...|||.|..
  Fly    72 VQSIAAFEARDDSNIEN---------------PTIPPSNLD--ESTTEKP--ATEAPGTTEKVTT 117

  Fly  1334 DHSEPGEAGLISEVLQFHSSGGDLPETDSRAIEPLPLAPPAEVIEVVPLGSAELLSPSEP--TEV 1396
              :.||....::.         :.|.|..:.....|  ...|.|.....|:.|.::...|  ||.
  Fly   118 --AAPGTTEKVTT---------EAPGTTEKITTEAP--GTTEKITTEAPGTTEKITTEAPGTTEK 169

  Fly  1397 VSPSAIALPEKPEPMENATEIEIEEMVSPTSVEIVPTTTEDLHQAESVVETARPVSAVEEVKPIE 1461
            ::..|....|||     ||:              .|.|||         :.|.......|.....
  Fly   170 ITTEAPGTTEKP-----ATD--------------APGTTE---------KPATDAPGTTEKSETT 206

  Fly  1462 DSTAAIDKSPQISPIEGEHSQHSEKETPESVEVGLDSPN-----------VADVITTSVEVIPTS 1515
            |:....|||...:||..|         |.:.|...|.||           :.|.:..:..:.||.
  Fly   207 DAPGTTDKSDTDAPITDE---------PSTAETSTDEPNTETTESGEETTIEDNVCATTGLFPTG 262

  Fly  1516 --TTAVTTSDGASTEMPEPPKIYCETAPPAAEEIEQNETVETLSVSADTT 1563
              |..:..|.....|:    |.|.:..|   .|::.:......|.|.|.|
  Fly   263 SCTHFIVCSYAEGDEL----KAYTKKCP---GEMQFDPFNSVCSASYDCT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43340NP_001246184.1 FYVE_BSN_PCLO 63..119 CDD:277290
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884 67/310 (22%)
MCLC <77..177 CDD:283562 28/131 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.