DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1358 and Y43D4A.3

DIOPT Version :9

Sequence 1:NP_001188873.1 Gene:CG1358 / 35697 FlyBaseID:FBgn0033196 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001041029.1 Gene:Y43D4A.3 / 189852 WormBaseID:WBGene00012789 Length:180 Species:Caenorhabditis elegans


Alignment Length:176 Identity:46/176 - (26%)
Similarity:77/176 - (43%) Gaps:26/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 MMFYLVAGLTSILL--VLMVIFFQDK-PPTPPSAAQEAAQLLESSEAEQVSFMQSLKNLMTNRNF 285
            |.|....|:..:.|  .::.:|.:.| |||||||:..|.|       ..:.|.:|:...:.|..|
 Worm     1 MFFTFTLGMECLALFPFVLALFVRTKLPPTPPSASSAAHQ-------NNIGFFKSILQCIFNAQF 58

  Fly   286 IFLLLSYGINVGVFYAISTLLNPVVLKYYP----GHEVDAGRIGLSIVLAGMLGSVVSGIVLDKT 346
            ...:..:.      :|.|.|.:.::....|    |:|: ||.......:.|.|.|:::|.:.|||
 Worm    59 FIQMTLFA------FAFSLLWSLMIFLDGPLKDQGYEM-AGYPTAVCAIVGTLTSLLAGHIADKT 116

  Fly   347 HKFKE---TTLAVYALSMVGMWIFTFTLDTG--HIAVVYLTASLLG 387
            .||||   .....::.|::.:.:|.....||  ...:||.....||
 Worm   117 RKFKEIIRVCTVGFSCSVITLRMFLNQPRTGLFDSIIVYTLYGCLG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1358NP_001188873.1 MFS_1 62..422 CDD:284993 46/176 (26%)
MFS 63..461 CDD:119392 46/176 (26%)
Y43D4A.3NP_001041029.1 MFS <2..>162 CDD:391944 43/173 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D702737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.