DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blow and F59A2.5

DIOPT Version :9

Sequence 1:NP_001163073.2 Gene:blow / 35694 FlyBaseID:FBgn0004133 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_497704.1 Gene:F59A2.5 / 175444 WormBaseID:WBGene00010305 Length:123 Species:Caenorhabditis elegans


Alignment Length:130 Identity:37/130 - (28%)
Similarity:53/130 - (40%) Gaps:33/130 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 PSPVYGLIDSSSMVLPKLPEKSNSPSALARRFEYDVPKCPAQPLQDTSSRVASVSGELESLGLLN 409
            ||..|  |.|:|:.|....|:       |.|...||.|...:|.:..:.|.....||...     
 Worm    20 PSTAY--IHSASVRLSVGTEE-------AARTVADVIKIDKEPRRSGARREVCSEGEFVV----- 70

  Fly   410 EGDIKVQPQ-PSSLHGSIS-----LDFQARVKTVHSELSTQLSAAGPSPDRLKKAAKKSYSNGSE 468
               ||::.: |.||..||:     :|..  |||:  :|...|   |.|.:   ...|:..||||:
 Worm    71 ---IKIESKDPKSLSKSIANAVDMIDLS--VKTI--KLCENL---GKSKE---NGLKRKLSNGSQ 122

  Fly   469  468
             Worm   123  122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blowNP_001163073.2 PH 206..307 CDD:278594
PH 206..307 CDD:214574
F59A2.5NP_497704.1 Pcc1 28..100 CDD:286431 23/90 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12352
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.