DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps13 and spo2

DIOPT Version :9

Sequence 1:NP_001260781.1 Gene:Vps13 / 35693 FlyBaseID:FBgn0033194 Length:3321 Species:Drosophila melanogaster
Sequence 2:NP_001343087.1 Gene:spo2 / 9407224 PomBaseID:SPBC16C6.14 Length:133 Species:Schizosaccharomyces pombe


Alignment Length:125 Identity:29/125 - (23%)
Similarity:49/125 - (39%) Gaps:20/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   986 VSCTIADKSS-------PEFSTKYNSTEQ--LVVANFEVLQIVLHQECLQRIMEVVNN--FQRNL 1039
            :|.|::|.|:       ..|.....:.|:  |:||..|.....:....|:.:.|..:|  :|..|
pombe     1 MSITMSDSSAYGEELMRERFEHLLKAYEKMALMVAEQEEFNAKIEDMALKLLSEKYDNEAYQAEL 65

  Fly  1040 DLVLSSTRPRDRMGSIGGGDGIKRTLNVILEDTEEIMTTDQMKRRKKTRRTHVVETVKVR 1099
            ...||:...:.....|...| :|.....|||.|        :|:..|......:|.||::
pombe    66 FYRLSNCVEKVLHNKISITD-LKTEYEEILEQT--------LKKECKAYERSCIENVKLK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps13NP_001260781.1 Chorein_N 4..113 CDD:315323
VPS13 140..370 CDD:318996
VPS13_mid_rpt 574..807 CDD:318998
SHR-BD 2349..2600 CDD:310922
VPS13 <2701..3232 CDD:330393
VPS13_C 2904..3074 CDD:318997
spo2NP_001343087.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5043
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001282
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.