| Sequence 1: | NP_610299.2 | Gene: | Vps13 / 35693 | FlyBaseID: | FBgn0033194 | Length: | 3321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_175173.2 | Gene: | AT1G47400 / 841144 | AraportID: | AT1G47400 | Length: | 50 | Species: | Arabidopsis thaliana |
| Alignment Length: | 46 | Identity: | 11/46 - (23%) |
|---|---|---|---|
| Similarity: | 19/46 - (41%) | Gaps: | 14/46 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3185 LMEATGNKIMKETDKGKFATTDNFIHCEEIIQKSEYLVVTNYRVMY 3230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Vps13 | NP_610299.2 | MRS6 | 4..>1969 | CDD:227376 | |
| VPS13 | 137..370 | CDD:465309 | |||
| SHR-BD | 2351..2599 | CDD:461974 | |||
| MRS6 | <2701..3232 | CDD:227376 | 11/46 (24%) | ||
| VPS13_C | 2904..3074 | CDD:465310 | |||
| AT1G47400 | NP_175173.2 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||