DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps13 and LOC101883170

DIOPT Version :9

Sequence 1:NP_001260781.1 Gene:Vps13 / 35693 FlyBaseID:FBgn0033194 Length:3321 Species:Drosophila melanogaster
Sequence 2:XP_005173849.2 Gene:LOC101883170 / 101883170 -ID:- Length:102 Species:Danio rerio


Alignment Length:85 Identity:32/85 - (37%)
Similarity:49/85 - (57%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 PYRKYRPYNIPYKGHARDWWHFAITSILEEEVRKPRESWTWGHIKTHRERCNTYAQKYKEQCLSK 375
            ||||:|| ::|...:||.||.:.|:||||..||:..:.|.|.:||.||:...:|...||.:    
Zfish    16 PYRKFRP-DVPVHRNARQWWKYGISSILEVHVRRFNQMWNWTNIKKHRQTLKSYKAAYKVK---- 75

  Fly   376 KPSAVLTETCRLLE-TELDV 394
                 ||::.::.| ||..:
Zfish    76 -----LTQSAKVREDTEKQI 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps13NP_001260781.1 Chorein_N 4..113 CDD:315323
VPS13 140..370 CDD:318996 26/58 (45%)
VPS13_mid_rpt 574..807 CDD:318998
SHR-BD 2349..2600 CDD:310922
VPS13 <2701..3232 CDD:330393
VPS13_C 2904..3074 CDD:318997
LOC101883170XP_005173849.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D4159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.