DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpe and AT1G63290

DIOPT Version :9

Sequence 1:NP_001260780.1 Gene:Rpe / 35692 FlyBaseID:FBgn0050499 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_176518.1 Gene:AT1G63290 / 842635 AraportID:AT1G63290 Length:227 Species:Arabidopsis thaliana


Alignment Length:215 Identity:108/215 - (50%)
Similarity:152/215 - (70%) Gaps:5/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQAKIGPSILNADLSNLAAESQKLLDNGADYLHLDVMDGTFVPNLTFGHPMVKSLRNKIKTAFFE 67
            |..||.||:|::|.:|||||:::::|.||::||:|:|||.||.|||.|.|:::||| |...|:.:
plant     4 VSPKIAPSMLSSDFANLAAEAKRMIDLGANWLHMDIMDGHFVSNLTIGAPVIESLR-KHTNAYLD 67

  Fly    68 THMMVQNPEQWIEPMADAGVNLYTFHVEPVQD-VVRVSRRVQESGMKVGLAIKPGTEVQD---LE 128
            .|:||.||..:::.||.||.:.:|||||..|: ...:.::::.:||:.|:|:||||.|:.   |.
plant    68 CHLMVTNPMDYVDQMAKAGASGFTFHVEVAQENWQELVKKIKAAGMRPGVALKPGTPVEQVYPLV 132

  Fly   129 KYLSIADVVLVMTVEPGFGGQSFMADMMPKVKWLRENYPNLDIEVDGGVGPKTIHCCAEAGANMI 193
            :..:..::|||||||||||||.||..||.||:.||..||.||||||||:||.||...|.||||.|
plant   133 EGTNPVEMVLVMTVEPGFGGQKFMPSMMDKVRALRNKYPTLDIEVDGGLGPSTIDAAAAAGANCI 197

  Fly   194 VSGTAVVGASDQSQVIKELR 213
            |:|::|.||.....||..||
plant   198 VAGSSVFGAPKPGDVISLLR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpeNP_001260780.1 RPE 6..213 CDD:238244 105/210 (50%)
AT1G63290NP_176518.1 PLN02334 1..227 CDD:215192 108/215 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 204 1.000 Domainoid score I836
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12005
Inparanoid 1 1.050 215 1.000 Inparanoid score I1227
OMA 1 1.010 - - QHG53606
OrthoDB 1 1.010 - - D1554029at2759
OrthoFinder 1 1.000 - - FOG0002457
OrthoInspector 1 1.000 - - otm2955
orthoMCL 1 0.900 - - OOG6_100819
Panther 1 1.100 - - LDO PTHR11749
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1871
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.