DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpe and RPE

DIOPT Version :9

Sequence 1:NP_001260780.1 Gene:Rpe / 35692 FlyBaseID:FBgn0050499 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_200949.1 Gene:RPE / 836262 AraportID:AT5G61410 Length:281 Species:Arabidopsis thaliana


Alignment Length:214 Identity:82/214 - (38%)
Similarity:127/214 - (59%) Gaps:9/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IGPSILNADLSNLAAESQKLLDNGADYLHLDVMDGTFVPNLTFGHPMVKSLRNKIKTAFFETHMM 71
            :.||||:|:.:.|..:.:.:...|.|::|:|||||.||||:|.|..:|.:|| .:.....:.|:|
plant    60 VSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALR-PVTDLPLDVHLM 123

  Fly    72 VQNPEQWIEPMADAGVNLYTFHVEPVQDVVRVSR---RVQESGMKVGLAIKPGTEVQDLEKYLSI 133
            :..|||.:.....||.::.:.|.|. |..:.:.|   :::..|.|.|:.:.|||.:..:|..|.:
plant   124 IVEPEQRVPDFIKAGADIVSVHCEQ-QSTIHLHRTVNQIKSLGAKAGVVLNPGTPLSAIEYVLDM 187

  Fly   134 ADVVLVMTVEPGFGGQSFMADMMPKVKWLR----ENYPNLDIEVDGGVGPKTIHCCAEAGANMIV 194
            .|:||:|:|.||||||||:...:.|:..||    |...|..|||||||.|...:...|||||.:|
plant   188 VDLVLIMSVNPGFGGQSFIESQVKKISDLRKMCAEKGVNPWIEVDGGVTPANAYKVIEAGANALV 252

  Fly   195 SGTAVVGASDQSQVIKELR 213
            :|:||.||.|.::.||.::
plant   253 AGSAVFGAKDYAEAIKGIK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpeNP_001260780.1 RPE 6..213 CDD:238244 82/212 (39%)
RPENP_200949.1 PLN02334 51..281 CDD:215192 82/214 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53606
OrthoDB 1 1.010 - - D1554029at2759
OrthoFinder 1 1.000 - - FOG0002457
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100819
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1871
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.