DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpe and Rpe

DIOPT Version :9

Sequence 1:NP_001260780.1 Gene:Rpe / 35692 FlyBaseID:FBgn0050499 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_008765509.1 Gene:Rpe / 501157 RGDID:1564890 Length:264 Species:Rattus norvegicus


Alignment Length:247 Identity:134/247 - (54%)
Similarity:166/247 - (67%) Gaps:37/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIGPSILNADLSNLAAESQKLLDNGADYLHLDVMDGTFVPNLTFGHPMVKSLRNKI--------- 61
            ||||||||:||:||.||..::||:||||||||||||.||||:|||||:|:|||.::         
  Rat     6 KIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFGSL 70

  Fly    62 -------------------KTAFF----ETHMMVQNPEQWIEPMADAGVNLYTFHVEPVQDVVRV 103
                               .|.||    :.||||..||||::|||.||.|.||||:|..::...:
  Rat    71 LSTFYLLSSVCPDAMPPSYPTHFFFLDLDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGAL 135

  Fly   104 SRRVQESGMK-----VGLAIKPGTEVQDLEKYLSIADVVLVMTVEPGFGGQSFMADMMPKVKWLR 163
            .:.::|:|||     |||||||||.|:.|..:.:..|:.||||||||||||.||.||||||.|||
  Rat   136 IKDIRENGMKHCLLQVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLR 200

  Fly   164 ENYPNLDIEVDGGVGPKTIHCCAEAGANMIVSGTAVVGASDQSQVIKELRDV 215
            ..:|.|||||||||||.|:..||||||||||||:|::.:.|...||..||:|
  Rat   201 TQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpeNP_001260780.1 RPE 6..213 CDD:238244 131/243 (54%)
RpeXP_008765509.1 RPE 6..250 CDD:238244 134/247 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336537
Domainoid 1 1.000 266 1.000 Domainoid score I1817
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12005
Inparanoid 1 1.050 274 1.000 Inparanoid score I2900
OMA 1 1.010 - - QHG53606
OrthoDB 1 1.010 - - D1554029at2759
OrthoFinder 1 1.000 - - FOG0002457
OrthoInspector 1 1.000 - - oto95867
orthoMCL 1 0.900 - - OOG6_100819
Panther 1 1.100 - - LDO PTHR11749
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1871
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.