DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpe and rpe

DIOPT Version :9

Sequence 1:NP_001260780.1 Gene:Rpe / 35692 FlyBaseID:FBgn0050499 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001121496.1 Gene:rpe / 100158597 XenbaseID:XB-GENE-1012408 Length:228 Species:Xenopus tropicalis


Alignment Length:209 Identity:131/209 - (62%)
Similarity:161/209 - (77%) Gaps:1/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIGPSILNADLSNLAAESQKLLDNGADYLHLDVMDGTFVPNLTFGHPMVKSLRNKI-KTAFFETH 69
            ||||||||:|||.|.||..::|.:||||||||||||.||||:|||||:|:.||.:: ...||:.|
 Frog     6 KIGPSILNSDLSRLGAECDRMLQSGADYLHLDVMDGHFVPNITFGHPVVECLRKQLGSDPFFDMH 70

  Fly    70 MMVQNPEQWIEPMADAGVNLYTFHVEPVQDVVRVSRRVQESGMKVGLAIKPGTEVQDLEKYLSIA 134
            |||..||||::||:.||.|.||||:|...:...:.:.::||||||||||||.|.|:.|..:.:..
 Frog    71 MMVAQPEQWVKPMSAAGANQYTFHLEATNNPGALIKDIRESGMKVGLAIKPNTTVEYLAPWANQI 135

  Fly   135 DVVLVMTVEPGFGGQSFMADMMPKVKWLRENYPNLDIEVDGGVGPKTIHCCAEAGANMIVSGTAV 199
            |:.||||||||||||.||.||||||:|||..:|:|||||||||||..||.||||||||||||:|:
 Frog   136 DMALVMTVEPGFGGQKFMEDMMPKVQWLRSQFPSLDIEVDGGVGPDNIHRCAEAGANMIVSGSAI 200

  Fly   200 VGASDQSQVIKELR 213
            :.:.|...|||.||
 Frog   201 MKSEDPRSVIKLLR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpeNP_001260780.1 RPE 6..213 CDD:238244 129/207 (62%)
rpeNP_001121496.1 RPE 6..214 CDD:238244 129/207 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 261 1.000 Domainoid score I1923
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12005
Inparanoid 1 1.050 270 1.000 Inparanoid score I2938
OMA 1 1.010 - - QHG53606
OrthoDB 1 1.010 - - D1554029at2759
OrthoFinder 1 1.000 - - FOG0002457
OrthoInspector 1 1.000 - - oto102603
Panther 1 1.100 - - LDO PTHR11749
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1196
SonicParanoid 1 1.000 - - X1871
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.