DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and PRSS27

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:292 Identity:103/292 - (35%)
Similarity:141/292 - (48%) Gaps:42/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1079 PMADLTCSNYECGRVKR----GRHKPSRRIIGGTQASPGNWPFLAAILGGPEKIFYCAGVLISDQ 1139
            |:..|.|  :...|.|.    ||.:...|::||.....|.||:..:|.....  .:|.|.||::|
Human     8 PLLLLLC--FGSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGS--HFCGGSLIAEQ 68

  Fly  1140 WVLTASHCVGNYSVIDLEDWTIQLGVTRRNSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQL 1204
            |||||:||..|.|...|  :.:.||..:...........:|:.|..:|.| ...|...|:||.:|
Human    69 WVLTAAHCFRNTSETSL--YQVLLGARQLVQPGPHAMYARVRQVESNPLY-QGTASSADVALVEL 130

  Fly  1205 ATRVAFHEHLLPVCLPPPSVRNLHPGTLCTVIGWGKREDKD----PKSTYEYIVNEVQVPIITRN 1265
            ...|.|..::||||||.||| ....|..|.|.|||...::|    |:     |:.::.||||...
Human   131 EAPVPFTNYILPVCLPDPSV-IFETGMNCWVTGWGSPSEEDLLPEPR-----ILQKLAVPIIDTP 189

  Fly  1266 QCDEWLDNL-------------TVSEGMVCAGFDDGGKDACQGDSGGPLLCPYPGEKNRWFVGGI 1317
            :|     ||             |:...|:||||::|.||||:|||||||:| ..|:.  |...|:
Human   190 KC-----NLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVC-LVGQS--WLQAGV 246

  Fly  1318 VSWGIMCAHPRLPGVYANVVQYVPWIQEQIAK 1349
            :|||..||....||||..|..:..||...|.|
Human   247 ISWGEGCARQNRPGVYIRVTAHHNWIHRIIPK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931 2/6 (33%)
Tryp_SPc 1103..1343 CDD:214473 92/256 (36%)
Tryp_SPc 1104..1346 CDD:238113 93/258 (36%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 92/256 (36%)
Tryp_SPc 36..275 CDD:238113 93/257 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.