DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and FZD7

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_003498.1 Gene:FZD7 / 8324 HGNCID:4045 Length:574 Species:Homo sapiens


Alignment Length:161 Identity:51/161 - (31%)
Similarity:73/161 - (45%) Gaps:17/161 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   734 LLAIAGGLAAYFNAYPTIKFVNKTIINTIHVEDTTSFGKNPAPGTCLPIIVRFCQGPQIPYNYTV 798
            :||:.|.|:|...|.|            .|.|...|.   |..|.|.||.:..|  ..|.||.|:
Human    19 VLALLGALSAGAGAQP------------YHGEKGISV---PDHGFCQPISIPLC--TDIAYNQTI 66

  Fly   799 FPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKCGQSGATVPPCKTLCTETMRRC 863
            .||.:||..|.:...::..:..||.|:|...:..|||:::.|.|......:|||::||....:.|
Human    67 LPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGC 131

  Fly   864 GFFFDVFGLSLPEYLNCKLFKDFPSSEDCVG 894
            ....:.||...||.|.|:.|....:.|.|||
Human   132 EALMNKFGFQWPERLRCENFPVHGAGEICVG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 37/115 (32%)
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
FZD7NP_003498.1 CRD_FZ7 45..169 CDD:143575 40/120 (33%)
7tmF_FZD7 243..573 CDD:320374
TM helix 1 253..277 CDD:320374
TM helix 2 286..307 CDD:320374
TM helix 3 337..359 CDD:320374
TM helix 4 380..396 CDD:320374
TM helix 5 418..441 CDD:320374
TM helix 6 472..494 CDD:320374
TM helix 7 523..548 CDD:320374
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 552..557
PDZ-binding 572..574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.