DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and FZD6

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001158087.1 Gene:FZD6 / 8323 HGNCID:4044 Length:706 Species:Homo sapiens


Alignment Length:195 Identity:56/195 - (28%)
Similarity:80/195 - (41%) Gaps:28/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   778 TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC 842
            ||.||.|..|.  ::.||.|.|||.:||:.|.....:::.:..|.::.|...:..|||..|||.|
Human    23 TCEPITVPRCM--KMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTC 85

  Fly   843 GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFK--------DFPSSEDCVGLDEVR 899
            .:....||||:.||.:....|....|.||:..||.|.|...:        .|....:.:|..:..
Human    86 IEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKT 150

  Fly   900 EVMR------AATHPKCDGFQ------CDQNRCLPQEYVCDGHLDCMDQADEAKCERCGPDEIYC 952
            |.::      ...|.|..|.|      .||  |.|.   |.......|:.:.|| ...|...|:|
Human   151 EQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ--CAPP---CPNMYFKSDELEFAK-SFIGTVSIFC 209

  Fly   953  952
            Human   210  209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 39/123 (32%)
LDLa 911..942 CDD:238060 9/36 (25%)
LDLa 945..979 CDD:238060 3/8 (38%)
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
FZD6NP_001158087.1 CRD_FZ6 20..146 CDD:143559 39/124 (31%)
Frizzled 189..507 CDD:279827 6/22 (27%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 498..503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 588..706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.