DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and FZD1

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_003496.1 Gene:FZD1 / 8321 HGNCID:4038 Length:647 Species:Homo sapiens


Alignment Length:211 Identity:56/211 - (26%)
Similarity:83/211 - (39%) Gaps:48/211 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   774 PAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLF 838
            |..|.|.||.:..|  ..|.||.|:.||.:||..|.:...::..:..||.|:|...:..|||:::
Human   111 PDHGYCQPISIPLC--TDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMY 173

  Fly   839 VPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVG--------- 894
            .|.|......:|||::||....:.|....:.||...|:.|.|:.|....:.|.|||         
Human   174 APVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTP 238

  Fly   895 ----LDEVREVMRAATHPKCDG------------------FQCDQNRCLPQ--EYVCDGHLDCMD 935
                |.|.     ..::|:..|                  |.|.:...:|.  .|...|..||  
Human   239 TPSLLPEF-----WTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDC-- 296

  Fly   936 QADEAKCERCGPDEIY 951
               .|.||   |.::|
Human   297 ---GAPCE---PTKVY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 36/115 (31%)
LDLa 911..942 CDD:238060 9/50 (18%)
LDLa 945..979 CDD:238060 2/7 (29%)
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
FZD1NP_003496.1 CRD_FZ1 112..238 CDD:143574 39/127 (31%)
Frizzled 310..634 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.