DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and TMPRSS5

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:425 Identity:132/425 - (31%)
Similarity:194/425 - (45%) Gaps:96/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   970 CPYG--------QDERNCLRLSERNGDVG----------------TGVLEVYRIGQRQWMPACVK 1010
            ||..        |||...|..||.:.:..                ..:||.....|.:|:..|.:
Human    73 CPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHE 137

  Fly  1011 NWDRAVSPSAVCSILGYSAVNATSVLTQLTHRPLLATVNVSTDIWKMYAKRKSTLMQEFA----- 1070
            .|..|:. ..:|..||:         .:|||.   ..||: |||       |....||||     
Human   138 GWSPALG-LQICWSLGH---------LRLTHH---KGVNL-TDI-------KLNSSQEFAQLSPR 181

  Fly  1071 -------------NCKKTEDYPMADLTCSNYECGRVKRGRHKP-SRRIIGGTQASPGNWPFLAAI 1121
                         ||...:   :..|.||  |||.      :| :.||:||...:||.||:.|::
Human   182 LGGFLEEAWQPRNNCTSGQ---VVSLRCS--ECGA------RPLASRIVGGQSVAPGRWPWQASV 235

  Fly  1122 LGGPEKIFYCAGVLISDQWVLTASHCVGNYSVIDLEDWTIQLGVTRRNSFTYSGQKVKVKAVIPH 1186
            ..|....  |.|.:::.:||:||:||:.::.:..|..|.:..|:. .:|.....|...|:.:|||
Human   236 ALGFRHT--CGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLV-SHSAVRPHQGALVERIIPH 297

  Fly  1187 PQYNMAIAHDNDIALFQLATRVAFHEHLLPVCLPPPSVRNLHPGTLCTVIGWGKREDKDPKSTYE 1251
            |.|: |..||.|:||.:|.|.:.|.:.:..||||... ::...|:.|.|.|||...   |..||.
Human   298 PLYS-AQNHDYDVALLRLQTALNFSDTVGAVCLPAKE-QHFPKGSRCWVSGWGHTH---PSHTYS 357

  Fly  1252 Y-IVNEVQVPIITRNQCDEWLDNLTVSEG-----MVCAGFDDGGKDACQGDSGGPLLCPYPGEKN 1310
            . ::.:..||:.:...|    ::..|..|     |:|||:.||..|||||||||||:||   :.:
Human   358 SDMLQDTVVPLFSTQLC----NSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCP---DGD 415

  Fly  1311 RWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWIQE 1345
            .|.:.|:||||..||.|..|||||.|.:::.||.:
Human   416 TWRLVGVVSWGRGCAEPNHPGVYAKVAEFLDWIHD 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060 5/16 (31%)
SR 980..>1034 CDD:214555 13/69 (19%)
SRCR 992..1086 CDD:278931 26/111 (23%)
Tryp_SPc 1103..1343 CDD:214473 90/245 (37%)
Tryp_SPc 1104..1346 CDD:238113 91/248 (37%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 31/128 (24%)
Tryp_SPc 217..448 CDD:214473 90/245 (37%)
Tryp_SPc 218..451 CDD:238113 91/248 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.