DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and prss60.1

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:259 Identity:93/259 - (35%)
Similarity:136/259 - (52%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1101 SRRIIGGTQASPGNWPFLAA----ILGGPEKIFYCAGVLISDQWVLTASHCVGNYSVIDLEDWTI 1161
            :.||:||..|..|:||:..:    |.||    .:|.|.||:.:|||||:||:...:...|   .:
Zfish    31 NNRIVGGVNAFDGSWPWQVSLHSPIYGG----HFCGGSLINSEWVLTAAHCLPRITTSSL---LV 88

  Fly  1162 QLG-VTRRNSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCLPPPSVR 1225
            .|| .|::...||...:. |..:..||.|| .:.::|||||..|::.|.|..::.||||  .:..
Zfish    89 FLGKTTQQGVNTYEINRT-VSVITVHPSYN-NLTNENDIALLHLSSAVTFSNYIRPVCL--AAQN 149

  Fly  1226 NLHP-GTLCTVIGWGKREDKDPKSTYEYIVNEVQVPIITRNQCDEWLDNLTVSEGMVCAGFDDGG 1289
            ::.| ||...:.|||..: .........|:.|..:|::..:||:..|.:.:|:..|:|||...||
Zfish   150 SVFPNGTSSWITGWGNIQ-LGVNLPAPGILQETMIPVVPNDQCNALLGSGSVTNNMICAGLLQGG 213

  Fly  1290 KDACQGDSGGPLL---CPYPGEKNRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWIQEQIAKH 1350
            :|.||||||||::   |..      |...||.|||..||.|..||||..|.||..||...|.::
Zfish   214 RDTCQGDSGGPMVSKQCLV------WVQSGITSWGYGCADPYSPGVYTRVSQYQSWINSIIVQN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473 90/248 (36%)
Tryp_SPc 1104..1346 CDD:238113 91/250 (36%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 90/248 (36%)
Tryp_SPc 34..267 CDD:238113 91/250 (36%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.