DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and sfrp1b

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001077040.1 Gene:sfrp1b / 798564 ZFINID:ZDB-GENE-061103-1 Length:300 Species:Danio rerio


Alignment Length:145 Identity:40/145 - (27%)
Similarity:59/145 - (40%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   753 FVNKTIINTIHVED----TTSFGKNPAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQT 813
            |:...::|.:..||    ..|..|:| |...:|..:|.|.  .:.|...:.||.:.|....|.:.
Zfish    15 FLCLPLLNALEDEDYIWPPDSSDKHP-PCVDIPEDLRLCF--NVGYGRMMLPNLLDHETIAEVKQ 76

  Fly   814 DLDSYEALVDVRCYELVSLFLCTLFVPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYL 878
            ...|:..||...|::...:.||:||.|.|  ....:.||:..|......|......||...||.|
Zfish    77 QAVSWVPLVHKACHKGTQVLLCSLFAPVC--LDRPLYPCRWFCEAVRDSCAPIMQAFGFPWPEML 139

  Fly   879 NCKLFKDFPSSEDCV 893
            .|   ..||..|.|:
Zfish   140 RC---DKFPLGEVCI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 32/116 (28%)
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
sfrp1bNP_001077040.1 CRD_SFRP1 36..159 CDD:143552 35/124 (28%)
NTR_Sfrp1_like 170..292 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.