DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and Prss8

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:292 Identity:99/292 - (33%)
Similarity:146/292 - (50%) Gaps:40/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1090 CGRVKRGRHKPSRRIIGGTQASPGNWPFLAAILGGPEKIFYCAGVLISDQWVLTASHCVGNYSVI 1154
            ||.|.:      .||.||..|.||.||:..:|......:  |.|.|:|::||::|:||.....  
Mouse    37 CGAVIQ------PRITGGGSAKPGQWPWQVSITYDGNHV--CGGSLVSNKWVVSAAHCFPREH-- 91

  Fly  1155 DLEDWTIQLGVTRRNSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCL 1219
            ..|.:.::||..:.:|::.......|..:|.|..|... ....||||.:|::.|.|..::.|:||
Mouse    92 SREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREE-GSQGDIALIRLSSPVTFSRYIRPICL 155

  Fly  1220 PPPSV---RNLHPGTLCTVIGWGKRED----KDPKSTYEYIVNEVQVPIITRNQCDEWLDNL--- 1274
            |..:.   ..||    |||.|||....    :.|:.     :.:::||:|:|..| ..|.|:   
Mouse   156 PAANASFPNGLH----CTVTGWGHVAPSVSLQTPRP-----LQQLEVPLISRETC-SCLYNINAV 210

  Fly  1275 -----TVSEGMVCAGFDDGGKDACQGDSGGPLLCPYPGEKNRWFVGGIVSWGIMCAHPRLPGVYA 1334
                 |:.:.|:|||:..||||||||||||||.||..|   .|::.||||||..|..|..||||.
Mouse   211 PEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEG---IWYLAGIVSWGDACGAPNRPGVYT 272

  Fly  1335 NVVQYVPWIQEQIAK-HSRPIKEDRVNKYDLH 1365
            ....|..||...:|: ..|.:.:.:.::.|.|
Mouse   273 LTSTYASWIHHHVAELQPRVVPQTQESQPDGH 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473 90/254 (35%)
Tryp_SPc 1104..1346 CDD:238113 91/256 (36%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 91/256 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.