DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and XB5723326

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:307 Identity:89/307 - (28%)
Similarity:147/307 - (47%) Gaps:48/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1108 TQASP--GNWPFLAAILGGPEKI-----FYCAGVLISDQWVLTASHCVGNYSVIDLEDW------ 1159
            |:.:|  |.||::.:|   .:|:     ..|||.:::::|::||:||        .:||      
 Frog    18 TELNPVEGKWPWIVSI---QKKVELGYKHICAGTILNNEWIITAAHC--------FKDWKEGDPT 71

  Fly  1160 ---TIQLGVTRRNSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCLPP 1221
               .:.||....:......|...||.:|.|.||: .|...|||||.||..:|.|.:|:...|.|.
 Frog    72 TPLRVLLGTFYLSEIGLRTQSRGVKQLIKHDQYD-PITESNDIALIQLDKQVEFSDHIQQACFPK 135

  Fly  1222 PSVRNLHPGTLCTVIGWGKR-EDKDPKSTYEYIVNEVQVPIITRNQCDEWLDNLTVSEGMVCAGF 1285
            .|. :|.....|::.|||.: :..|..|.:   :.|.||..|....|::|...: :.|..:|||.
 Frog   136 ESA-DLKDLIDCSIAGWGAQGKHLDEPSQF---LQEAQVERIDTKHCNKWYQGI-LGENHLCAGH 195

  Fly  1286 DDGGKDACQGDSGGPLLCPYPGEKNRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWIQEQIAKH 1350
            ..|.:..|.||.|.||:| ...:.|.:.|.||::||..|...|.||||:.:..::.||.|:    
 Frog   196 RKGPEKTCNGDRGSPLMC-RTKKNNVYSVIGILNWGSGCGQTRSPGVYSPIQSHIKWIVEK---- 255

  Fly  1351 SRPIKEDRVNKYDLHPGGPDILSKIATDPMREGAPHHYTHSRTSSKN 1397
               :|.:.| |..:.  |..::.|:....::   |.|...:|.:::|
 Frog   256 ---VKNEAV-KATIQ--GKRLVPKLLFPLVK---PDHMNPNRNTAQN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473 77/251 (31%)
Tryp_SPc 1104..1346 CDD:238113 79/254 (31%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 75/244 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.