DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and SFRP5

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_003006.2 Gene:SFRP5 / 6425 HGNCID:10779 Length:317 Species:Homo sapiens


Alignment Length:260 Identity:65/260 - (25%)
Similarity:99/260 - (38%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   769 SFGKNPAPGTCL--PIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVS 831
            |:.|   |..||  |..:..|.  .:.|.....||.:.|....|.:....|:..|:..||:....
Human    46 SYSK---PPQCLDIPADLPLCH--TVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQ 105

  Fly   832 LFLCTLFVPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSED-CVGL 895
            :|||:||.|.|  ....:.||::||......|....:.:|...||.|:|   ..||...| |:. 
Human   106 VFLCSLFAPVC--LDRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHC---HKFPLDNDLCIA- 164

  Fly   896 DEVREVMRAATHPKCDGF--QCDQNRCLPQEYVCDGHLDCMDQADEAKCERCGPDEIYCGDSQCI 958
              |:.....||.|.....  ||:      .|:..||.::.|..:|.....|....:|..||.:.|
Human   165 --VQFGHLPATAPPVTKICAQCE------MEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLI 221

  Fly   959 GTKHICDGIIDCPYGQDERNCLRLSERNG---------DVGTGVLEVYRIGQRQWMPACVKNWDR 1014
            |.:.....:...|..:.:...|.|..:||         .:....|.:.|....|.:...|..||:
Human   222 GAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDK 286

  Fly  1015  1014
            Human   287  286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 34/118 (29%)
LDLa 911..942 CDD:238060 7/32 (22%)
LDLa 945..979 CDD:238060 6/33 (18%)
SR 980..>1034 CDD:214555 10/44 (23%)
SRCR 992..1086 CDD:278931 6/23 (26%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
SFRP5NP_003006.2 CRD_SFRP5 47..173 CDD:143553 37/138 (27%)
NTR_Sfrp1_like 178..303 CDD:239635 24/115 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.