DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and SFRP1

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_003003.3 Gene:SFRP1 / 6422 HGNCID:10776 Length:314 Species:Homo sapiens


Alignment Length:334 Identity:72/334 - (21%)
Similarity:112/334 - (33%) Gaps:90/334 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   718 GRLKFRLFQILINAFALLAIAGGLAAY--------FNAYPTIKFVNKTIINTIHVEDTTSFGKNP 774
            ||....|..:|....||||: |..:.|        ...|.:.:|..|                  
Human     9 GRRGAALGVLLALGAALLAV-GSASEYDYVSFQSDIGPYQSGRFYTK------------------ 54

  Fly   775 APGTC--LPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTL 837
             |..|  :|..:|.|.  .:.|...|.||.:.|....|.:....|:..|::..|:....:|||:|
Human    55 -PPQCVDIPADLRLCH--NVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSL 116

  Fly   838 FVPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGL-----DE 897
            |.|.|  ....:.||:.||......|......||...||.|.|   ..||..:.|:.:     .|
Human   117 FAPVC--LDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKC---DKFPEGDVCIAMTPPNATE 176

  Fly   898 VREVMRAATHPKCDGFQCDQNRCLPQ---EYVCDGHLDCMDQADEAKCERCGPDEIYCGDSQCIG 959
            ..:.......|.||      |....:   |::|........:..|.|.|.        ||.:.:.
Human   177 ASKPQGTTVCPPCD------NELKSEAIIEHLCASEFALRMKIKEVKKEN--------GDKKIVP 227

  Fly   960 TK-------------------HICDGIIDCPYGQDERNCLRLSERNGDVGTGVLEVYRIGQRQWM 1005
            .|                   ::.:| .|||       |.:|.    ::....|.:.|..:.|::
Human   228 KKKKPLKLGPIKKKDLKKLVLYLKNG-ADCP-------CHQLD----NLSHHFLIMGRKVKSQYL 280

  Fly  1006 PACVKNWDR 1014
            ...:..||:
Human   281 LTAIHKWDK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 34/117 (29%)
LDLa 911..942 CDD:238060 5/33 (15%)
LDLa 945..979 CDD:238060 7/52 (13%)
SR 980..>1034 CDD:214555 6/35 (17%)
SRCR 992..1086 CDD:278931 5/23 (22%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
SFRP1NP_003003.3 CRD_SFRP1 52..175 CDD:143552 36/148 (24%)
NTR_Sfrp1_like 183..306 CDD:239635 23/133 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.