DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Corin and fzd8a

DIOPT Version :9

Sequence 1:	NP_610297.2	Gene:	Corin / 35691	FlyBaseID:	FBgn0033192	Length:	1397	Species:	Drosophila melanogaster
Sequence 2:	NP_570993.2	Gene:	fzd8a / 58073	ZFINID:	ZDB-GENE-000328-3	Length:	579	Species:	Danio rerio

Alignment Length:	106	Identity:	33/106 - (31%)
Similarity:	52/106 - (49%)	Gaps:	3/106 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   778 TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC 842
            ||..|.|..|:|  |.||||..||...|..|.|...::..:..||:::|...:..|||:::.|.|
Zfish    29 TCQEIAVPLCKG--IGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPIC 91

  Fly   843 GQS-GATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKL 882
            .:. ...:|||:::|......|......:|...|:.:.|.|
Zfish    92 LEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDL 132

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Corin	NP_610297.2	CRD_FZ	778..894	CDD:143549	33/106 (31%)
		LDLa	911..942	CDD:238060
		LDLa	945..979	CDD:238060
		SR	980..>1034	CDD:214555
		SRCR	992..1086	CDD:278931
		Tryp_SPc	1103..1343	CDD:214473
		Tryp_SPc	1104..1346	CDD:238113
fzd8a	NP_570993.2	CRD_FZ8	26..150	CDD:143570	33/106 (31%)
		7tmF_FZD8	228..537	CDD:320378
		TM helix 1	237..262	CDD:320378
		TM helix 2	271..292	CDD:320378
		TM helix 3	321..343	CDD:320378
		TM helix 4	364..380	CDD:320378
		TM helix 5	402..425	CDD:320378
		TM helix 6	453..478	CDD:320378
		TM helix 7	498..523	CDD:320378
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3577
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900