DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and fzd3a

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:XP_005160805.1 Gene:fzd3a / 565921 ZFINID:ZDB-GENE-990415-225 Length:686 Species:Danio rerio


Alignment Length:189 Identity:52/189 - (27%)
Similarity:84/189 - (44%) Gaps:25/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 TIINTIHVEDTTSFGKNPAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEAL 821
            |:...|::|.|.|.    :..:|.||.:|.|||  :.||.|..||.:.|:.|......::.:..:
Zfish    12 TVCMAINMEATGSH----SMFSCEPITLRMCQG--LAYNTTFMPNLLNHYDQQTAALAMEPFHPM 70

  Fly   822 VDVRCYELVSLFLCTLFVPKCGQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLF--- 883
            |::.|...:..|||.|:.|.|.:.|....||:.||......|....::||:|.|:.:.|..|   
Zfish    71 VNLECSTEIRPFLCALYAPVCTEYGRVTLPCRRLCQRAKSDCYKLMEMFGVSWPDEMECSRFPEC 135

  Fly   884 -KDFPSSEDCVGLDEVREVMRAATHPKCDGFQCDQNRCLPQE--------YVCDGHLDC 933
             :.:|.:.|.:...:..|...:|.. :..||.|      |:|        |...|..||
Zfish   136 EESYPRAIDLLPSSDSTEESPSAVQ-RDYGFWC------PRELKIEPDLGYSFMGVRDC 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 36/119 (30%)
LDLa 911..942 CDD:238060 9/31 (29%)
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
fzd3aXP_005160805.1 CRD_FZ3 26..152 CDD:143558 36/127 (28%)
Frizzled 195..513 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.