DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and frzb2

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001016688.2 Gene:frzb2 / 549442 XenbaseID:XB-GENE-876718 Length:300 Species:Xenopus tropicalis


Alignment Length:255 Identity:54/255 - (21%)
Similarity:84/255 - (32%) Gaps:69/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   778 TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC 842
            |.:|..:..|.  .|.|:....||.:.|....|......|:..|:...|:....:|||:||.|.|
 Frog    44 TRIPRSMALCY--DIGYSEMRIPNLLEHDTMAEVIQQSSSWLPLLARECHPDARIFLCSLFAPIC 106

  Fly   843 GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVREVMRAATH 907
              ....:.||::||......|......:|...||.|                             
 Frog   107 --LDRYIYPCRSLCEAVRGSCAPIMACYGYPWPEIL----------------------------- 140

  Fly   908 PKCDGFQCDQNRCLPQEYVCDGHLDCMDQADEAKCERCGPDEIYCGDSQCIGTKHICDGIIDCPY 972
             :||.|..|...|:..  :.:|..........|.|..|..:|       ....|.|.|...|   
 Frog   141 -RCDKFPEDHGMCISP--ITNGTGSTRRTVPRASCRDCELEE-------ASTAKEILDTFCD--- 192

  Fly   973 GQDERNCLRLSERN--------GDVGTGVLEVYRIGQ----------RQWM---PACVKN 1011
             .|....:|::::|        .|:.: .||:.:.|.          :||:   ..||:|
 Frog   193 -NDFVAKVRITKKNITSANLYDFDLDS-KLEILKHGSLPKTDVLPRLQQWLDLDATCVQN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 28/115 (24%)
LDLa 911..942 CDD:238060 6/30 (20%)
LDLa 945..979 CDD:238060 7/33 (21%)
SR 980..>1034 CDD:214555 11/53 (21%)
SRCR 992..1086 CDD:278931 8/33 (24%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
frzb2NP_001016688.2 CRD_crescent 41..175 CDD:143562 36/166 (22%)
NTR_Sfrp1_like 169..298 CDD:239635 20/94 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.