DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and LOXL2

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_002309.1 Gene:LOXL2 / 4017 HGNCID:6666 Length:774 Species:Homo sapiens


Alignment Length:579 Identity:118/579 - (20%)
Similarity:178/579 - (30%) Gaps:231/579 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   728 LINAFALLAIAGGLA-AYFNAYPTIKFVNKTIINTIHVEDTTSFGKNPAPGTCLPIIVRFCQGPQ 791
            |.:..|:||:...|: |.::::|             |..:   :.:.|||        .:.| ||
Human     9 LCSCLAMLALLSPLSLAQYDSWP-------------HYPE---YFQQPAP--------EYHQ-PQ 48

  Fly   792 IPYNYT-----------------VFPNYIGHFGQLETQTDLDSYEALVDVRCYEL---------- 829
            .|.|..                 |...|.|.:|   |..|.|.......|.|.||          
Human    49 APANVAKIQLRLAGQKRKHSEGRVEVYYDGQWG---TVCDDDFSIHAAHVVCRELGYVEAKSWTA 110

  Fly   830 ------------VSLFLCT---LFVPKCGQSGATVPPCK------TLCTETMRRCGFFFDVFGLS 873
                        :....||   ..:..|..:|..|..||      .:|:: .|..||.||...::
Human   111 SSSYGKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSD-KRIPGFKFDNSLIN 174

  Fly   874 LPEYLNCKLFKDFPSSEDCVGLDEVREVMRAATHPKCDGF-QCDQNRCLPQEYVCDGHLDCMDQA 937
            ..|.||.::       || :.:..:....|..| |..:|: :..:.:...|  :||.|.      
Human   175 QIENLNIQV-------ED-IRIRAILSTYRKRT-PVMEGYVEVKEGKTWKQ--ICDKHW------ 222

  Fly   938 DEAKCERCGPDEIYCG-----------------------------DSQCIGTK-HI--------- 963
             .||..|     :.||                             ...|.||: ||         
Human   223 -TAKNSR-----VVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQV 281

  Fly   964 ---------CD----GIIDCPYGQ---------------DERNCLRLSERNGD-VGTGVLEVYRI 999
                     |:    .::.|..||               .|:..:||  |.|. :|.|.:||.:.
Human   282 SLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYKPEQPLVRL--RGGAYIGEGRVEVLKN 344

  Fly  1000 GQRQWMPACVKNWDRAVSPSAVCSILGYSAVNATSVLTQLTH-------RPLLATVNVSTDI-WK 1056
            |  :|...|...|| .||.|.||..||:.:.......::|..       ..:..|.|..:.| .|
Human   345 G--EWGTVCDDKWD-LVSASVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCK 406

  Fly  1057 MYAKRKSTLMQEFANCKKTEDYPMADLTCSNYECGRVKRGRHKPSRRIIGGTQASPG-------- 1113
            ..|        |...|...||   |.:.|:....|..|:      .|:.||.....|        
Human   407 FNA--------ESQGCNHEED---AGVRCNTPAMGLQKK------LRLNGGRNPYEGRVEVLVER 454

  Fly  1114 ------------NWPFLAAI-------LGGPEKIF----YCAGVLISDQWVLTASHCVG 1149
                        ||..:.|:       ||.....|    |..|.:.|::.|::...|.|
Human   455 NGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSG 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 34/163 (21%)
LDLa 911..942 CDD:238060 6/31 (19%)
LDLa 945..979 CDD:238060 12/100 (12%)
SR 980..>1034 CDD:214555 20/54 (37%)
SRCR 992..1086 CDD:278931 26/101 (26%)
Tryp_SPc 1103..1343 CDD:214473 16/78 (21%)
Tryp_SPc 1104..1346 CDD:238113 15/77 (19%)
LOXL2NP_002309.1 SR 58..159 CDD:214555 18/103 (17%)
SRCR 67..159 CDD:278931 18/94 (19%)
SR 196..301 CDD:214555 19/119 (16%)
SRCR 203..301 CDD:278931 16/111 (14%)
SR 326..425 CDD:214555 31/114 (27%)
SRCR 331..425 CDD:278931 28/107 (26%)
SR 435..544 CDD:214555 16/79 (20%)
SRCR 440..544 CDD:278931 14/74 (19%)
Lysyl-oxidase like 548..751
Lysyl_oxidase 548..743 CDD:279521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.