DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Corin and ovch1

DIOPT Version :9

Sequence 1:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:296 Identity:92/296 - (31%)
Similarity:143/296 - (48%) Gaps:41/296 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1072 CKK-------TEDYPMADLTCSNYE--------CGRVKRGR------HKPSRRIIGGTQASPGNW 1115
            |||       |..:..||...|::|        |..:...|      .....|||||.:|...:|
Zfish     4 CKKCLFILILTLKWTKADSDASSFETDCILDKGCDVLAGIRSFVPEDEVEESRIIGGKEAWAHSW 68

  Fly  1116 PFLAAILGGPEKIFYCAGVLISDQWVLTASHCVGNYSVIDLEDWTIQLGV-TRRNSFTYSGQKVK 1179
            |:..::  ....:..|.|.::...||:||.||...|....:  |...:|: ...|:...|.:.::
Zfish    69 PWQVSL--QYNDVPTCGGAILDQLWVITAGHCFKRYKKPSM--WNAVVGLHNLDNANESSRESIQ 129

  Fly  1180 VKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCLPPPSVRN--LHPGTLCTVIGWGKRE 1242
            |:.:..|..||.. .::|||||.:|.:.:.|.:.:.|:     .|.|  |.|...|||.|||...
Zfish   130 VQKIFSHKNYNQK-TNENDIALLKLQSPLVFSKFVRPI-----GVFNNDLPPLVTCTVTGWGSVT 188

  Fly  1243 DKDPKSTYEYIVNEVQVPIITRNQCDEWLDNLTVSEGMVCAGFDDGGKDACQGDSGGPLLCPYPG 1307
            :..|:::.   :.||.|.:....:|:.:... .|.:.|:|||.::||.|||||||||||.| :.|
Zfish   189 ENGPQASR---LQEVNVTVYEPQKCNRFYRG-KVLKSMICAGANEGGMDACQGDSGGPLSC-FDG 248

  Fly  1308 EKNRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWI 1343
            |  |:.:.|:||||:.|...:.||||..:..|..|:
Zfish   249 E--RYKLAGVVSWGVGCGRAQKPGVYTTLYHYRQWM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931 6/20 (30%)
Tryp_SPc 1103..1343 CDD:214473 81/242 (33%)
Tryp_SPc 1104..1346 CDD:238113 81/243 (33%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 81/241 (34%)
Tryp_SPc 57..281 CDD:238113 80/240 (33%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.